PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G082000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 247aa    MW: 26731.3 Da    PI: 8.1038
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G082000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.13.6e-0727561948
                        TTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding 19 lGggtWktIartmgkgRtlkqcksrwqkyl 48
                         G  +W ++++  g+ R++k+c++rw +yl
  Sevir.2G082000.1.p 27 NGQCCWGAVPKLAGLLRCGKSCRLRWTNYL 56
                        45559*********99************97 PP

2Myb_DNA-binding26.21.9e-0865100447
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          ++eE++  ++++++lG++        ++ gRt++++k++w+++
  Sevir.2G082000.1.p  65 LSPEEEKTVINLHAELGNR-------PLP-GRTDNDIKNHWNTH 100
                         69***************99.......688.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF002491.7E-52756IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-112763IPR009057Homeodomain-like
SuperFamilySSF466891.2E-1543110IPR009057Homeodomain-like
PROSITE profilePS5129418.25557105IPR017930Myb domain
SMARTSM007179.4E-461103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-1564105IPR009057Homeodomain-like
PfamPF002491.3E-665100IPR001005SANT/Myb domain
CDDcd001671.16E-666101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRQPCCDKV GGHGRRRRTR SSFLVNNGQC CWGAVPKLAG LLRCGKSCRL RWTNYLRPDL  60
KRGLLSPEEE KTVINLHAEL GNRPLPGRTD NDIKNHWNTH IKKKLRKMGI DPATHKPLQP  120
APPQPNEEEK AAAASAIVSG VELGNEAFSI SEVPMVHLLD DVVLPYDLVA GAPPASNSGI  180
DTAYSPEPSS SSSSCSGSAT VSSCASSVVD GVPGLAGSRC CWTPWTFEDP FVTYQRIALF  240
DHQETW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-152810526108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3673902e-53AK367390.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2056F10.
GenBankAK3752632e-53AK375263.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3089G21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956764.11e-125PREDICTED: myb-related protein 315-like
TrEMBLK4A0V71e-125K4A0V7_SETIT; Uncharacterized protein
STRINGSi032498m1e-125(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.11e-60myb domain protein 20